Skip to main content

Table 2 VH, linker and VL nucleotide sequence and predicted amino acid sequence of VH, linker, VL and conserved intimin (Gly388 - Lys667)

From: Cloning approach and functional analysis of anti-intimin single-chain variable fragment (scFv)

Nucleotide Sequences
CHAINS SEQUENCES [GenBank:GU722326]
VH GTGCAGCTGCAGGAGTCTGGACCTGAGGTGGTGAAGCCTGGGACTTCAGTGAAGATATCCTGTAAGGCTTCTGGATACACGGTCACTGACTACTACATGAACTGGGTGAAGCAGAGCCATGGAAAGAGCCTTGAGTGGATTGGAGATATTAATCTTGACAATCGTGATTGTAGTTATAACCAGAAGTTCCAGGACAAGGCCACATTGACTGTAGACAAGTCGTCCAGCACAGTCTACATGGAGATCCGCAGCCTGACTTCTGAGGACTCTGCAGTCTATTACTGTGCAAGTCAACTGGGTCACTGGGGCCAAGGGACCACGGTCACCGTCTCC
Linker GGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCG
VL GACATTGTGCTGACCCAGTCTCCAGCTTCCTTAGCTGTATCTCTGGGGCAGAGGGCCACCATCTCATACAGGGCCAGCAAAAGTGTCAGTACATCTGGCTATAGTTATATGCACTGGAACCAACAGAAACCAGGACAGCCACCCAGACTCCTCGTCTATCTTGTATCCAACCTAGAATCTGGGGTCCCTGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACCCTCAACATCCATCCTGTGGAGGAGGAGGATGCTGCAACCTATTACTGTCAGCACATTAGGGAGCTTACACGTTCGGAGGGGGCACCAAGCTGGAAATCAAAC
Amino Acid Sequences
CHAINS SEQUENCES
VH VQLQESGPEVVKPGTSVKISCKASGYTVTDYYMNWVKQSHGKSLEWIGDINLDNRDCSYNQKFQDKATLTVDKSSSTVYMEIRSLTSEDSAVYYCASQLGHWGQGTTVTVS
Linker GGGGSGGGGSGGGGS
VL DIVLTQSPASLAVSLGQRATISYRASKSVSTSGYSYMHWNQQKPGQPPRLLVYLVSNLESGVPARFSGSGSGTDFTLNIHPVEEEDAATYYCQHIRELTRSEGAPSWKSN
Int388-667 [GenBank:CAS11487] GIDYRHGTGNENDLLYSMQFRYQFDKPWSQQIEPQYVNELRTLSGSRYDLVQRNNNIILEYKKQDILSLNIPHDINGTERSTQKIQLIVKSKYGLDRIVWDDSALRSQGGQIQHSGSQSAQDYQAILPAYVQGGSNVYKVTARAYDRNGNSSNNVLLTITVLSNGQVVDQVGVTDFTADKTSAKADGTEAITYTATVKKNGVAQANVPVSFNIVSGTAVLSANSANTNGSGKATVTLKSDKPGQVVVSAKTAEMTSALNANAVIFVDQTKASITEIKADK