Skip to main content


Springer Nature is making SARS-CoV-2 and COVID-19 research free. View research | View latest news | Sign up for updates

Table 1 Viral protein and peptide targets used for anti-arbovirus DNA aptamer development

From: Development, screening, and analysis of DNA aptamer libraries potentially useful for diagnosis and passive immunity of arboviruses

Virus protein or peptide Molec. Wt. Commercial sources and amino acid sequence of peptides and applicable references
Chikungunya E1a Peptide 5,605 daltons (amino acids 200–250) GenScript, Inc. (Piscataway, NJ): GDIQSRTPES KDVYANTQLVLQRPAVGTVHVPYSQAPSGF KYWLKERGAS; Santhosh et al. [13] and Pubmed Protein Sequence Database
CCHF Altamura Gn 611 1,641 daltons GenScript; TQ EGRGHVKL SRGSE Altamura et al., 2007 [16]
CCHF 11E7a 3,391 daltons GenScript; GLKFASLTCTGCYACSSGISCKVRIHVDEPDE Ahmed, et al., 2005 and Altamura et al. 2007 [15, 16]
CCHF 11E7b 4,482 daltons GenScript; VAASSSLMARKLEFGTDSTFKAFSAMPKTSLCFYIVEREY Ahmed, et al., 2005 and Altamura et al. 2007 [15, 16]
CCHF 11E7c 3,152 daltons Genscript; EDTQ KCVNTKL EQPQSILIEHKGTIIGK Ahmed, et al., 2005 and Altamura et al. 2007 [15, 16]
Recombinant dengue Type 1 41 kD E (envelope) antigen Virostat, Inc. (Portland, ME) Product No. 8812
Recombinant dengue Type 2 15 kD E antigen Virostat; Product No. 8813
Recombinant dengue Type 3 15 kD E antigen Virostat; Product No. 8814
Recombinant dengue Type 4 15 kD E antigen Virostat; Product No. 8815
TBEV CE/gE   Feldan Bio Corp. (Quebec, Canada) Cat. No. FB03-80-149
WNV E Protein ~ 42 kD E protein GenWay Biotech (San Diego, CA) Cat. No. 10-511-248224