Skip to main content

Table 1 Viral protein and peptide targets used for anti-arbovirus DNA aptamer development

From: Development, screening, and analysis of DNA aptamer libraries potentially useful for diagnosis and passive immunity of arboviruses

Virus protein or peptide

Molec. Wt.

Commercial sources and amino acid sequence of peptides and applicable references

Chikungunya E1a Peptide

5,605 daltons (amino acids 200–250)

GenScript, Inc. (Piscataway, NJ): GDIQSRTPES KDVYANTQLVLQRPAVGTVHVPYSQAPSGF KYWLKERGAS; Santhosh et al. [13] and Pubmed Protein Sequence Database

CCHF Altamura Gn 611

1,641 daltons

GenScript; TQ EGRGHVKL SRGSE Altamura et al., 2007 [16]

CCHF 11E7a

3,391 daltons

GenScript; GLKFASLTCTGCYACSSGISCKVRIHVDEPDE Ahmed, et al., 2005 and Altamura et al. 2007 [15, 16]

CCHF 11E7b

4,482 daltons

GenScript; VAASSSLMARKLEFGTDSTFKAFSAMPKTSLCFYIVEREY Ahmed, et al., 2005 and Altamura et al. 2007 [15, 16]

CCHF 11E7c

3,152 daltons

Genscript; EDTQ KCVNTKL EQPQSILIEHKGTIIGK Ahmed, et al., 2005 and Altamura et al. 2007 [15, 16]

Recombinant dengue Type 1

41 kD E (envelope) antigen

Virostat, Inc. (Portland, ME) Product No. 8812

Recombinant dengue Type 2

15 kD E antigen

Virostat; Product No. 8813

Recombinant dengue Type 3

15 kD E antigen

Virostat; Product No. 8814

Recombinant dengue Type 4

15 kD E antigen

Virostat; Product No. 8815

TBEV CE/gE

 

Feldan Bio Corp. (Quebec, Canada) Cat. No. FB03-80-149

WNV E Protein

~ 42 kD E protein

GenWay Biotech (San Diego, CA) Cat. No. 10-511-248224