Skip to main content

Table 1 Identification of map-HBHA by mass spectrometry analysis

From: Purification of native HBHA from Mycobacterium avium subsp. paratuberculosis

Peptides identified by HR-MS/MS Peptide position start - end Peptide modification
2AacENPNIDDLR11 2-11 Acetylated
60FQEDLPEQFTELR72 60-72  
73DKFTTEELR81 73-81  
82KAAEGYLEAATNR94 82-94  
83AAEGYLEAATNR94 83-94  
109LRSQTAFEDASAR121 109-121  
111SQTAFEDASAR121 111-121  
111SQTAFEDASARAEGYVDQAVELTQEALGTVASQTR 145 111-145  
122AEGYVDQAVELTQEALGTVASQTR145 122-145  
151AAKmeLVGIELPGK162 151-162 Methylated
154LVGIELPGK162 154-162  
154LVGIELPGKAEAAGKme168 154-168 Methylated
154LVGIELPGKAEAAGKK169 154-169  
Peptides highlighted onto sequencea   
  1. MA ac ENPNIDDLR APLLAALGAADLALATVNDLIANLRERAEETRAETRTRVEERRARLTKFQEDLPEQFTELRDKFTTEELR KAAEGYLEAATNR YNELVERGEAALQRLRSQTAFEDASARAEGYVDQAVELTQEALGTVASQTR AVGERAAK me LVGIELPGKAEAAGK me K AQKAIAKAPAKKAPAKRVTQK.
  2. aThe 13 peptides identified by HR-MS/MS, text in italic, correspond to 52% of sequence coverage.